SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7669520|ref|NP_039254.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7669520|ref|NP_039254.1|
Domain Number 1 Region: 36-135
Classification Level Classification E-value
Superfamily Immunoglobulin 1.7e-17
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 178-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000179
Family EGF-type module 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|7669520|ref|NP_039254.1|
Sequence length 462
Comment pro-neuregulin-1, membrane-bound isoform isoform ndf43 [Homo sapiens]
Sequence
MSERKEGRGKGKGKKKERGSGKKPESAAGSQSPALPPRLKEMKSQESAAGSKLVLRCETS
SEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGN
DSASANITIVESNEIITGMPASTEGAYVSSESPIRISVSTEGANTSSSTSTSTTGTSHLV
KCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQ
KRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSERNNMMNIANGPHHPN
PPPENVQLVNQYVSKNVISSEHIVEREAETSFSTSHYTSTAHHSTTVTQTPSHSWSNGHT
ESILSESHSVIVMSSVENSRHSSPTGGPRGRLNGTGGPRECNSFLRHARETPDSYRDSPH
SERHNLIAELRRNKAHRSKCMQIQLSATHLRSSSIPHLGFIL
Download sequence
Identical sequences A0A2I2Y6T0 A0A2J8X5M4 K7CGP9
NP_039254.1.87134 NP_039254.1.92137 XP_003311705.1.37143 XP_008954427.1.60992 XP_018888307.1.27298 ENSP00000428828 gi|7669520|ref|NP_039254.1| ENSP00000428828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]