SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7705318|ref|NP_057399.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7705318|ref|NP_057399.1|
Domain Number 1 Region: 9-158
Classification Level Classification E-value
Superfamily PH domain-like 3.47e-49
Family Phosphotyrosine-binding domain (PTB) 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|7705318|ref|NP_057399.1|
Sequence length 304
Comment PTB domain-containing engulfment adapter protein 1 [Homo sapiens]
Sequence
MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIK
KSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSES
NKHLCYVFDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETEN
MELKNKVQDLENQLRITQVSAPPAGSMTPKSPSTDIFDMIPFSPISHQSSMPTRNGTQPP
PVPSRSTEIKRDLFGAEPFDPFNCGAADFPPDIQSKLDEMQEGFKMGLTLEGTVFCLDPL
DSRC
Download sequence
Identical sequences H2R2G7 Q9UBP9
ENSPTRP00000043938 ENSPTRP00000043938 gi|7705318|ref|NP_057399.1| NP_057399.1.87134 NP_057399.1.92137 XP_001162585.1.37143 XP_001163056.1.37143 XP_003825306.1.60992 XP_003825307.1.60992 XP_016859795.1.92137 ENSP00000386289 9598.ENSPTRP00000043938 9606.ENSP00000352047 ENSP00000352047 ENSP00000386289 ENSP00000386732 ENSP00000386867 ENSP00000352047 ENSP00000386289 ENSP00000386732 ENSP00000386867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]