SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7705330|ref|NP_057403.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|7705330|ref|NP_057403.1|
Domain Number - Region: 166-235
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0671
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|7705330|ref|NP_057403.1|
Sequence length 275
Comment COP9 signalosome complex subunit 7a [Homo sapiens]
Sequence
MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDF
ASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEAL
ALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEWCVG
CEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLT
ELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN
Download sequence
Identical sequences A0A250YE84 A0A2J8TBE0 A0A2K5F5R0 A0A2K5QYL1 A0A2K6GB01 F2Z5Q3 F7I285 G1QX83 G3R1B7 H0WT81 K7AR25 M3XEA0 M3YZH0 Q5R762 Q9UBW8 U6CUS8
9598.ENSPTRP00000007839 9600.ENSPPYP00000004784 9606.ENSP00000229251 9823.ENSSSCP00000000737 ENSFCAP00000024956 ENSMPUP00000016730 gi|255759877|ref|NP_001157567.1| gi|255760064|ref|NP_001157565.1| gi|255760066|ref|NP_001157566.1| gi|7705330|ref|NP_057403.1| ENSPPYP00000004784 GO.35390 ENSCJAP00000014626 ENSPPYP00000004784 ENSSSCP00000000737 ENSP00000229251 ENSPTRP00000007839 ENSNLEP00000005554 ENSPTRP00000007839 ENSP00000229251 ENSP00000438115 ENSP00000438363 ENSP00000441852 ENSP00000446039 ENSP00000229251 ENSP00000438115 ENSP00000438363 ENSP00000441852 ENSP00000446039 ENSNLEP00000005554 ENSOGAP00000005339 ENSMPUP00000016730 ENSOGAP00000005339 ENSCJAP00000014626 ENSGGOP00000008973 ENSSSCP00000000737 NP_001126414.1.23681 NP_001157565.1.87134 NP_001157565.1.92137 NP_001157566.1.87134 NP_001157566.1.92137 NP_001157567.1.87134 NP_001157567.1.92137 NP_057403.1.87134 NP_057403.1.92137 XP_001925656.2.46622 XP_002752308.1.60252 XP_002752309.1.60252 XP_003126576.1.46622 XP_003273792.1.23891 XP_003273793.1.23891 XP_003355646.1.46622 XP_003796445.1.62490 XP_003820334.1.60992 XP_003820335.1.60992 XP_003988377.1.62641 XP_003988378.1.62641 XP_004052627.1.27298 XP_004052628.1.27298 XP_004052629.1.27298 XP_004092198.1.23891 XP_004413965.1.74151 XP_004413966.1.74151 XP_004413967.1.74151 XP_004438765.1.5094 XP_004438766.1.5094 XP_004438767.1.5094 XP_004692950.1.23501 XP_004692951.1.23501 XP_004766732.1.14098 XP_005253751.1.92137 XP_005365269.1.66349 XP_005365270.1.66349 XP_005365271.1.66349 XP_005652655.1.46622 XP_006210928.1.17985 XP_006737910.1.47382 XP_006737911.1.47382 XP_006933520.1.62641 XP_007089665.1.5354 XP_007089666.1.5354 XP_007089667.1.5354 XP_008512188.1.77740 XP_008512189.1.77740 XP_008681758.1.72690 XP_008681759.1.72690 XP_008681760.1.72690 XP_008681761.1.72690 XP_008823608.1.79516 XP_008823609.1.79516 XP_008823610.1.79516 XP_008971929.1.60992 XP_008971930.1.60992 XP_008971931.1.60992 XP_012328284.1.9421 XP_012328285.1.9421 XP_012493340.1.63892 XP_012493341.1.63892 XP_012615956.1.48125 XP_012615957.1.48125 XP_012919022.1.14098 XP_012919023.1.14098 XP_014722041.1.49734 XP_014722042.1.49734 XP_014722043.1.49734 XP_015100445.1.17985 XP_015100446.1.17985 XP_017401576.1.71028 XP_017401577.1.71028 XP_017501434.1.32401 XP_017501435.1.32401 XP_017501436.1.32401 XP_018893497.1.27298 XP_018893498.1.27298 XP_018893499.1.27298 XP_019320243.1.44245 XP_019320244.1.44245 XP_019320245.1.44245 XP_020013891.1.5219 XP_020013892.1.5219 XP_020013893.1.5219 XP_020013894.1.5219 XP_020013895.1.5219 XP_021492644.1.76796 XP_021492646.1.76796 XP_021492647.1.76796 XP_021492648.1.76796 XP_021492649.1.76796 XP_021546182.1.83697 XP_021546183.1.83697 ENSGGOP00000008973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]