SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7705383|ref|NP_057536.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7705383|ref|NP_057536.1|
Domain Number 1 Region: 19-320
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.72e-115
Family Calpain large subunit, catalytic domain (domain II) 0.000000000066
Further Details:      
 
Domain Number 2 Region: 323-466
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 5.76e-53
Family Calpain large subunit, middle domain (domain III) 0.00000239
Further Details:      
 
Domain Number 3 Region: 484-661
Classification Level Classification E-value
Superfamily EF-hand 3.91e-44
Family Penta-EF-hand proteins 0.0000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|7705383|ref|NP_057536.1|
Sequence length 664
Comment calpain-9 isoform 2 [Homo sapiens]
Sequence
MPYLYRAPGPQAHPVPKDARITHSSGQSFEQMRQECLQRGTLFEDADFPASNSSLFYSER
PQIPFVWKRPGEIVKNPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVIPQD
QSFGPGYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKL
NGSYEALKGGSAIEAMEDFTGGVAETFQTKEAPENFYEILEKALKRGSLLGCFIDTRSAA
ESEARTPFGLIKGHAYSVTGIDQVSFRGQRIELIRIRNPWGQVEWNGSWSDRMAFKDFKA
HFDKVEICNLTPDALEEDAIHKWEVTVHQGSWVRGSTAGGCRNFLDTFWTNPQIKLSLTE
KDEGQEECSFLVALMQKDRRKLKRFGANVLTIGYAIYECPDKDEHLNKDFFRYHASRARS
KTFINLREVSDRFKLPPGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMDGNVDIDLPE
PPKPTPPDQETEEEQRFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKLSLISC
KNIISLMDTSGNGKLEFDEFKVFWDKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQ
LSSHLLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALSTKNKEFIHLNINEFIHL
TMNI
Download sequence
Identical sequences gi|7705383|ref|NP_057536.1| ENSP00000346538 ENSP00000346538 NP_057536.1.87134 NP_057536.1.92137 XP_003824514.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]