SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7705696|ref|NP_056997.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7705696|ref|NP_056997.1|
Domain Number 1 Region: 35-159
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.88e-18
Family Thioltransferase 0.000000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|7705696|ref|NP_056997.1|
Sequence length 172
Comment thioredoxin domain-containing protein 12 precursor [Homo sapiens]
Sequence
METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVI
IHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDP
SGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL
Download sequence
Identical sequences H2PZ09 O95881
ENSP00000360688 ENSPTRP00000001261 O95881 ENSP00000360688 ENSP00000360688 gi|7705696|ref|NP_056997.1| NP_056997.1.87134 NP_056997.1.92137 XP_008974564.1.60992 XP_009456020.1.37143 ENSPTRP00000001261 9598.ENSPTRP00000001261 9606.ENSP00000360688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]