SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7705726|ref|NP_057043.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7705726|ref|NP_057043.1|
Domain Number 1 Region: 132-231
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.09e-17
Family Thioltransferase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|7705726|ref|NP_057043.1|
Sequence length 296
Comment thioredoxin-related transmembrane protein 2 isoform 1 [Homo sapiens]
Sequence
MAVLAPLIALVYSVPRLSRWLAQPYYLLSALLSAAFLLVRKLPPLCHGLPTQREDGNPCD
FDWREVEILMFLSAIVMMKNRRSITVEQHIGNIFMFSKVANTILFFRLDIRMGLLYITLC
IVFLMTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADL
SLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGR
AVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK
Download sequence
Identical sequences Q9Y320
ENSP00000278422 ENSP00000367562 gi|7705726|ref|NP_057043.1| 9606.ENSP00000278422 NP_057043.1.87134 NP_057043.1.92137 ENSP00000278422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]