SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|7706687|ref|NP_057421.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|7706687|ref|NP_057421.1|
Domain Number 1 Region: 4-143
Classification Level Classification E-value
Superfamily PH domain-like 3.47e-41
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000023
Further Details:      
 
Domain Number 2 Region: 378-414
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.000000000000497
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0013
Further Details:      
 
Weak hits

Sequence:  gi|7706687|ref|NP_057421.1|
Domain Number - Region: 186-326
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000126
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|7706687|ref|NP_057421.1|
Sequence length 418
Comment ena/VASP-like protein [Homo sapiens]
Sequence
MATSEQSICQARASVMVYDDTSKKWVPIKPGQQGFSRINIYHNTASNTFRVVGVKLQDQQ
VVINYSIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNIMNSQEGG
PSSQRQVQNGPSPDEMDIQRRQVMEQHQQQRQESLERRTSATGPILPPGHPSSAASAPVS
CSGPPPPPPPPVPPPPTGATPPPPPPLPAGGAQGSSHDESSMSGLAAAIAGAKLRRVQRP
EDASGGSSPSGTSKSDANRASSGGGGGGLMEEMNKLLAKRRKAASQSDKPAEKKEDESQM
EDPSTSPSPGTRAASQPPNSSEAGRKPWERSNSVEKPVSSILSRTPSVAKSPEAKSPLQS
QPHSRMKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGISTT
Download sequence
Identical sequences A0A2K5J123
ENSP00000376652 9606.ENSP00000376652 ENSP00000376652 gi|7706687|ref|NP_057421.1| ENSP00000384720 NP_057421.1.87134 NP_057421.1.92137 XP_011806872.1.43180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]