SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78190480|ref|NP_001030009.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78190480|ref|NP_001030009.1|
Domain Number 1 Region: 50-224
Classification Level Classification E-value
Superfamily EF-hand 2.32e-47
Family Calmodulin-like 0.0000000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78190480|ref|NP_001030009.1|
Sequence length 227
Comment Kv channel-interacting protein 1 isoform 1 [Homo sapiens]
Sequence
MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDELEMTMVCHRPEGLEQLEAQTNFT
KRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFE
DFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKED
TPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM
Download sequence
Identical sequences A0A096NP12 A0A2I3FW50 A0A2K5BZD7 A0A2K5IIN0 A0A2K5QI30 A0A2K5WE99 A0A2K5YR96 A0A2K6CV38 A0A2K6L352 A0A2K6PGZ7 A0A2K6RZD1 F6VXX9 H2PHC3 H2QRZ8 Q9NZI2
ENSP00000395323 9598.ENSPTRP00000029925 9600.ENSPPYP00000017946 9606.ENSP00000395323 ENSPPYP00000017946 ENSP00000395323 gi|78190480|ref|NP_001030009.1| ENSPPYP00000017946 NP_001030009.1.87134 NP_001030009.1.92137 XP_002816227.1.23681 XP_003273275.1.23891 XP_005558552.1.63531 XP_008013467.1.81039 XP_010363179.1.97406 XP_011738348.1.29376 XP_011803153.1.43180 XP_011824047.1.47321 XP_012316544.1.9421 XP_017403189.1.71028 XP_017704903.1.44346 ENSPTRP00000029925 ENSPTRP00000029925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]