SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78190486|ref|NP_001030175.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78190486|ref|NP_001030175.1|
Domain Number 1 Region: 44-221
Classification Level Classification E-value
Superfamily EF-hand 1.27e-48
Family Calmodulin-like 0.000000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78190486|ref|NP_001030175.1|
Sequence length 225
Comment Kv channel-interacting protein 4 isoform 5 [Homo sapiens]
Sequence
MSGCRKRCKREILKFAQYLLRLLTGSLHTDSVEDELEMATVRHRPEALELLEAQSKFTKK
ELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDF
IKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAP
RQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI
Download sequence
Identical sequences A0A287D774 A0A2I3SL95 A0A2J8UL95 A0A2K5CAA0 A0A2K5JQ78 A0A2K5PIX3 A0A2K6KAJ6 A0A2K6N8G4 A0A2K6V059 Q3UFC0
gi|78190486|ref|NP_001030175.1| NP_001030175.1.87134 NP_001030175.1.92137 NP_001186173.1.92730 XP_003310304.1.37143 XP_003732571.1.60252 XP_003826873.2.60992 XP_004375200.1.4749 XP_004432369.1.5094 XP_004482530.1.11602 XP_004616602.1.94378 XP_004624596.1.9945 XP_004656146.1.11716 XP_004762751.1.14098 XP_005318984.1.77405 XP_005366072.1.66349 XP_005402528.1.28644 XP_006208183.1.17985 XP_006919027.1.64745 XP_006976162.1.50099 XP_008015968.1.81039 XP_010589692.1.64505 XP_011363464.1.92234 XP_011791065.1.43180 XP_012327769.1.9421 XP_012593137.1.48125 XP_013834010.1.46622 XP_013968138.1.84170 XP_015337481.1.40921 XP_015976763.1.101085 XP_016073733.1.3490 XP_017396103.1.71028 XP_017454577.1.100692 XP_017536470.1.32401 XP_017722297.1.44346 XP_019309453.1.44245 XP_019685255.1.62641 XP_021066790.1.100879 ENSP00000371583 ENSP00000371583 ENSMUSP00000135799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]