SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78190488|ref|NP_001030176.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78190488|ref|NP_001030176.1|
Domain Number 1 Region: 7-184
Classification Level Classification E-value
Superfamily EF-hand 8.95e-49
Family Calmodulin-like 0.000000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78190488|ref|NP_001030176.1|
Sequence length 188
Comment Kv channel-interacting protein 4 isoform 3 [Homo sapiens]
Sequence
MATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDST
TYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEML
DIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRS
MQLFENVI
Download sequence
Identical sequences A0A0D9RVH6 A0A0G2KAZ2 A0A1D5QKI0 A0A1S2ZYC8 A0A2J8NW46 A0A2J8ULA5 F7DKJ5 Q3V060
ENSP00000351892 ENSP00000423257 ENSECAP00000015984 ENSECAP00000015984 ENSSTOP00000018341 ENSSSCP00000022878 gi|22212900|ref|NP_671711.1| gi|78190488|ref|NP_001030176.1| 10116.ENSRNOP00000042016 9796.ENSECAP00000015984 ENSP00000351892 ENSP00000423257 ENSRNOP00000042016 ENSMUSP00000098776 ENSMUSP00000135071 NP_001030176.1.87134 NP_001030176.1.92137 NP_671711.1.87134 NP_671711.1.92137 XP_003258572.1.23891 XP_004415223.1.74151 XP_004624598.1.9945 XP_007526513.1.11023 XP_007526515.1.11023 XP_007951956.1.48129 XP_010375514.1.97406 XP_010608734.1.5607 XP_015976765.1.101085 XP_016864142.1.92137 XP_017176667.1.92730 XP_017454579.1.100692 XP_020008415.1.5219 XP_020956215.1.46622 XP_021535078.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]