SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78190495|ref|NP_001030086.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78190495|ref|NP_001030086.1|
Domain Number 1 Region: 49-226
Classification Level Classification E-value
Superfamily EF-hand 2.56e-49
Family Calmodulin-like 0.000000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78190495|ref|NP_001030086.1|
Sequence length 230
Comment calsenilin isoform 2 [Homo sapiens]
Sequence
MGIQGMELCAMAVVVLLFIAVLKQFGILEPISMEDSSDSELELSTVRHQPEGLDQLQAQT
KFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQFFPQGDATTYAHFLFNAFDADGNGAI
HFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRHTYPIL
REDAPAEHVERFFEKMDRNQDGVVTIEEFLEACQKDENIMSSMQLFENVI
Download sequence
Identical sequences NP_001030086.1.87134 NP_001030086.1.92137 ENSP00000417499 ENSP00000417499 gi|78190495|ref|NP_001030086.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]