SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78482626|ref|NP_912730.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78482626|ref|NP_912730.2|
Domain Number 1 Region: 118-179
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000626
Family B-box zinc-binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 18-111
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000778
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  gi|78482626|ref|NP_912730.2|
Domain Number - Region: 181-238
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0128
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78482626|ref|NP_912730.2|
Sequence length 358
Comment tripartite motif-containing protein 54 isoform 2 [Homo sapiens]
Sequence
MNFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCANDVFQASNP
LWQSRGSTTVSSGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESSRPLHSKA
EQHLMCEEHEEEKINIYCLSCEVPTCSLCKVFGAHKDCEVAPLPTIYKRQKSELSDGIAM
LVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFESLCAVLEERKGELLQALAREQE
EKLQRVRGLIRQYGDHLEASSKLVESAIQSMEEPQMALYLQQAKELINKVGAMSKVELAG
RPEPGYESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVAPDGEEGSAGPEEERPDGP
Download sequence
Identical sequences H2QHM3 Q9BYV2
gi|78482626|ref|NP_912730.2| ENSP00000369415 ENSP00000369415 NP_912730.2.87134 NP_912730.2.92137 XP_001155913.1.37143 XP_003827150.1.60992 XP_008950708.1.60992 XP_016803732.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]