SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78482627|ref|NP_115935.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78482627|ref|NP_115935.3|
Domain Number 1 Region: 119-178
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000366
Family B-box zinc-binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 18-111
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000942
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  gi|78482627|ref|NP_115935.3|
Domain Number - Region: 224-280
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0191
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78482627|ref|NP_115935.3|
Sequence length 400
Comment tripartite motif-containing protein 54 isoform 1 [Homo sapiens]
Sequence
MNFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCANDVFQASNP
LWQSRGSTTVSSGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESSRPLHSKA
EQHLMCEEHEEEKINIYCLSCEVPTCSLCKVFGAHKDCEVAPLPTIYKRQKKQDLTLLPR
LECSGTNTTYCSLDLPSSSDPPILASQNTKIIDSELSDGIAMLVAGNDRVQAVITQMEEV
CQTIEDNSRRQKQLLNQRFESLCAVLEERKGELLQALAREQEEKLQRVRGLIRQYGDHLE
ASSKLVESAIQSMEEPQMALYLQQAKELINKVGAMSKVELAGRPEPGYESMEQFTVRVEH
VAEMLRTIDFQPGASGEEEEVAPDGEEGSAGPEEERPDGP
Download sequence
Identical sequences A0A2I3T965
ENSP00000296098 ENSP00000296098 9598.ENSPTRP00000020204 9606.ENSP00000296098 NP_115935.3.87134 NP_115935.3.92137 ENSPTRP00000020204 ENSP00000296098 ENSPTRP00000020204 gi|78482627|ref|NP_115935.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]