SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78486553|ref|NP_892011.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78486553|ref|NP_892011.2|
Domain Number 1 Region: 6-84
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-18
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78486553|ref|NP_892011.2|
Sequence length 174
Comment enhancer of filamentation 1 isoform 2 [Homo sapiens]
Sequence
MKYKNLMARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRV
KLLIGPMQETASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQV
PTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVFQRDGQVSYFLVRASKQTSL
Download sequence
Identical sequences A0A2I2YIM8
ENSP00000368745 ENSP00000368745 gi|78486553|ref|NP_892011.2| NP_892011.2.87134 NP_892011.2.92137 XP_004043321.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]