SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|80978934|ref|NP_055729.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|80978934|ref|NP_055729.2|
Domain Number 1 Region: 559-671
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.83e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00041
Further Details:      
 
Domain Number 2 Region: 68-237
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.35e-34
Family G proteins 0.00000189
Further Details:      
 
Domain Number 3 Region: 344-409,499-544
Classification Level Classification E-value
Superfamily PH domain-like 3.18e-17
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 4 Region: 683-773
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.64e-16
Family Ankyrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|80978934|ref|NP_055729.2|
Sequence length 804
Comment arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 isoform 2 [Homo sapiens]
Sequence
MNYQQQLANSAAIRAEIQRFESVHPNIYSIYELLERVEEPVLQNQIREHVIAIEDAFVNS
QEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLL
LIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQD
AISSANPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSI
GPCKSLPNSPSHSSVCSAQVSAVHISQTSNGGGSLSDYSSSVPSTPSTSQKELRIDVPPT
ANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQGMLLKRSGKS
LNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSACAPI
SSPKTNGLSKDMSSLHISPNSDTGLGDSVCSSPSISSTTSPKLDPPPSPHANRKKHRRKK
STSNFKADGLSGTAEEQEENFEFIIVSLTGQTWHFEATTYEERDAWVQAIESQILASLQS
CESSKNKSRLTSQSEAMALQSIRNMRGNSHCVDCETQNPNWASLNLGALMCIECSGIHRN
LGTHLSRVRSLDLDDWPVELIKVMSSIGNELANSVWEESSQGRTKPSVDSTREEKERWIR
AKYEQKLFLAPLPCTELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEGDGRTAL
HLACRKGNVVLAQLLIWYGVDVTARDAHGNTALAYARQASSQECIDVLLQYGCPDERFVL
MATPNLSRRNNNRNNSSGRVPTII
Download sequence
Identical sequences gi|80978934|ref|NP_055729.2| ENSP00000338378 ENSP00000338378 NP_055729.2.87134 NP_055729.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]