SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83715966|ref|NP_001001669.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83715966|ref|NP_001001669.2|
Domain Number 1 Region: 11-225
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.2e-47
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 256-452
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.25e-37
Family BAR domain 0.01
Further Details:      
 
Domain Number 3 Region: 592-672
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-18
Family SH3-domain 0.00067
Further Details:      
 
Domain Number 4 Region: 494-568
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000459
Family SH3-domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|83715966|ref|NP_001001669.2|
Sequence length 675
Comment rho guanine nucleotide exchange factor 37 [Homo sapiens]
Sequence
MAKHGADEPSSRSGSPDREGRASEDRSLLHQRLAVRELIDTEVSYLHMLQLCASDIRSRL
QQLPQGDLDVLFSNIDDIIKVNSRFLHDLQETASKEEEQVQLVGNIFLEFQEELEQVYKV
YCASYDQALLLVDTYRKEPELQRHIQGIVEAVVPQAGSSGLSFLLVIPLQRITRYPLLLQ
KILENTVPDASAYPVLQRAVSALQDVNTNINEYKMRKEVASKYTKVEQLTLRERLARINT
HTLSKKTTRLSQLLKQEAGLIPRTEDKEFDDLEERFQWVSLCVTELKNNVAAYLDNLQAF
LYFRPHEYNLDIPEGPAVQYCNLARDLHLEAFLKFKQRLEGLVWQPLCSLAKALLGPQNL
IKKRLDKLLDFERVEEKLLEVGSVTYQEEAARHTYQALNSLLVAELPQFNQLVMQWLGQI
MCTFVTLQRDLAKQVLQRAEGSMAQLPHHHVPEPAFRKLVEDALGRTSNQLRSFQETFEK
VQPPPTTQPLLPGSERQVQALLSRYGPGKLYQVTSNISGTGTLDLTLPRGQIVAILQNKD
TKGNSGRWLVDTGGHRGYVPAGKLQLYHVVPSAEELRRQAGLNKDPRCLTPEPSPALVPS
IPTMNQVIAAYPFVARSSHEVSLQAGQPVTILEAQDKKGNPEWSLVEVNGQRGYVPSGFL
ARARSPVLWGWSLPS
Download sequence
Identical sequences A1IGU5
ENSP00000328083 ENSP00000425621 gi|83715966|ref|NP_001001669.2| NP_001001669.2.87134 NP_001001669.2.92137 XP_005268504.1.92137 XP_006714847.1.92137 ENSP00000328083 9606.ENSP00000328083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]