SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|8393264|ref|NP_058637.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|8393264|ref|NP_058637.1|
Domain Number 1 Region: 341-465
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000408
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 277-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000159
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 3 Region: 315-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000145
Family EGF-type module 0.0099
Further Details:      
 
Weak hits

Sequence:  gi|8393264|ref|NP_058637.1|
Domain Number - Region: 227-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0323
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|8393264|ref|NP_058637.1|
Sequence length 618
Comment delta-like protein 3 isoform 1 precursor [Homo sapiens]
Sequence
MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFF
RVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTF
SFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEP
PAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCL
EGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTC
PRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQ
PCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALG
FGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAP
PGLRPGDPQRYLLPPALGLLVAAGVAGAALLLVHVRRRGHSQDAGSRLLAGTPEPSVHAL
PDALNNLRTQEGSGDGPSSSVDWNRPEDVDPQGIYVISAPSIYAREVATPLFPPLHTGRA
GQRQHLLFPYPSSILSVK
Download sequence
Identical sequences Q9NYJ7
gi|8393264|ref|NP_058637.1| ENSP00000205143 ENSP00000205143 ENSP00000348810 9606.ENSP00000205143 NP_058637.1.87134 NP_058637.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]