SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83977459|ref|NP_031376.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83977459|ref|NP_031376.3|
Domain Number 1 Region: 141-190,228-284
Classification Level Classification E-value
Superfamily PH domain-like 0.000000902
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Weak hits

Sequence:  gi|83977459|ref|NP_031376.3|
Domain Number - Region: 184-225
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00068
Family beta-sandwich domain of Sec23/24 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|83977459|ref|NP_031376.3|
Sequence length 401
Comment pleckstrin homology-like domain family A member 1 [Homo sapiens]
Sequence
MRRAPAAERLLELGFPPRCGRQEPPFPLGVTRGWGRWPIQKRREGARPVPFSERSQEDGR
GPAARSSGTLWRIRTRLSLCRDPEPPPPLCLLRVSLLCALRAGGRGSRWGEDGARLLLLP
PARAAGNGEAEPSGGPSYAGRMLESSGCKALKEGVLEKRSDGLLQLWKKKCCILTEEGLL
LIPPKQLQHQQQQQQQQQQQQQQQPGQGPAEPSQPSGPAVASLEPPVKLKELHFSNMKTV
DCVERKGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQMVQYKNRQAILAVKSTRQKQQ
HLVQQQPPSQPQPQPQLQPQPQPQPQPQPQPQSQPQPQPQPKPQPQQLHPYPHPHPHPHS
HPHSHPHPHPHPHPHQIPHPHPQPHSQPHGHRLLRSTSNSA
Download sequence
Identical sequences Q8WV24
NP_031376.3.87134 NP_031376.3.92137 gi|83977459|ref|NP_031376.3| 9606.ENSP00000266671 ENSP00000266671 ENSP00000266671 ENSP00000480767 ENSP00000266671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]