SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85861250|ref|NP_077307.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85861250|ref|NP_077307.2|
Domain Number 1 Region: 122-301
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 6.67e-50
Family CRAL/TRIO domain 0.0000387
Further Details:      
 
Domain Number 2 Region: 40-118
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 9.29e-21
Family CRAL/TRIO N-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|85861250|ref|NP_077307.2|
Sequence length 342
Comment alpha-tocopherol transfer protein-like [Homo sapiens]
Sequence
MSEESDSLRTSPSVASLSENELPPPPEPPGYVCSLTEDLVTKAREELQEKPEWRLRDVQA
LRDMVRKEYPNLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCRRSWPEVFNNLKPSA
LKDVLASGFLTVLPHTDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQV
NGIVILADYKGVSLSKASHFGPFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGIFAIIK
PFLKEKIANRFFLHGSDLNSLHTNLPRSILPKEYGGTAGELDTATWNAVLLASEDDFVKE
FCQPVPACDSILGQTLLPEGLTSDAQCDDSLRAVKSQLYSCY
Download sequence
Identical sequences G3QQ35 Q9BTX7
ENSP00000262605 ENSP00000262605 ENSP00000361995 ENSP00000262605 ENSP00000361995 ENSGGOP00000004693 9606.ENSP00000262605 NP_001034288.1.87134 NP_001034288.1.92137 NP_077307.2.87134 NP_077307.2.92137 XP_004062248.1.27298 XP_011527345.1.92137 XP_011527346.1.92137 XP_018872576.1.27298 gi|85861243|ref|NP_001034288.1| gi|85861250|ref|NP_077307.2| ENSGGOP00000004693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]