SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|86788140|ref|NP_001034548.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|86788140|ref|NP_001034548.1|
Domain Number 1 Region: 68-193
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-20
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|86788140|ref|NP_001034548.1|
Sequence length 247
Comment engulfment and cell motility protein 1 isoform 2 [Homo sapiens]
Sequence
MQVVKEQVMRALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKI
QPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVP
HDSLQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSILYDSNCQLNFIAPDKH
EYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNY
DFVYDCN
Download sequence
Identical sequences A0A1U7TYX0 A0A2J8JDV9 F7HW87 H0X197 Q4R4Y7 Q5R518
gi|86788140|ref|NP_001034548.1| ENSCJAP00000043310 ENSCJAP00000051902 ENSMMUP00000035235 ENSMMUP00000035236 ENSP00000379355 ENSP00000379360 ENSOGAP00000008750 ENSP00000379355 ENSP00000379360 NP_001034548.1.87134 NP_001034548.1.92137 NP_001125753.1.23681 NP_569709.1.87134 NP_569709.1.92137 NP_932761.1.92730 XP_003268986.1.23891 XP_003268989.1.23891 XP_005369948.1.66349 XP_005549843.1.63531 XP_006254149.1.100692 XP_007979791.1.81039 XP_007979792.1.81039 XP_007979793.1.81039 XP_008063035.1.4292 XP_008843653.1.79516 XP_010339615.1.74449 XP_010339616.1.74449 XP_011767447.1.29376 XP_011805537.1.43180 XP_011805539.1.43180 XP_011828291.1.47321 XP_011828294.1.47321 XP_011939617.1.92194 XP_012316694.1.9421 XP_012633033.1.48125 XP_012659833.1.62490 XP_014201124.1.60992 XP_014989198.1.72884 XP_015345715.1.40921 XP_015862828.1.50099 XP_016812766.1.37143 XP_017199920.1.1745 XP_017357726.1.71028 XP_017830616.1.60252 XP_021511171.1.76796 XP_021577955.1.77405 ENSOGAP00000008750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]