SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|86990456|ref|NP_849161.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|86990456|ref|NP_849161.2|
Domain Number 1 Region: 42-321
Classification Level Classification E-value
Superfamily L domain-like 3.4e-54
Family Ngr ectodomain-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|86990456|ref|NP_849161.2|
Sequence length 522
Comment leucine-rich repeat transmembrane neuronal protein 1 precursor [Homo sapiens]
Sequence
MDFLLLGLCLYWLLRRPSGVVLCLLGACFQMLPAAPSGCPQLCRCEGRLLYCEALNLTEA
PHNLSGLLGLSLRYNSLSELRAGQFTGLMQLTWLYLDHNHICSVQGDAFQKLRRVKELTL
SSNQITQLPNTTFRPMPNLRSVDLSYNKLQALAPDLFHGLRKLTTLHMRANAIQFVPVRI
FQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAHFPRLISLHSLCL
RRNKVAIVVSSLDWVWNLEKMDLSGNEIEYMEPHVFETVPHLQSLQLDSNRLTYIEPRIL
NSWKSLTSITLAGNLWDCGRNVCALASWLNNFQGRYDGNLQCASPEYAQGEDVLDAVYAF
HLCEDGAEPTSGHLLSAVTNRSDLGPPASSATTLADGGEGQHDGTFEPATVALPGGEHAE
NAVQIHKVVTGTMALIFSFLIVVLVLYVSWKCFPASLRQLRQCFVTQRRKQKQKQTMHQM
AAMSAQEYYVDYKPNHIEGALVIINEYGSCTCHQQPARECEV
Download sequence
Identical sequences Q86UE6
NP_849161.2.87134 NP_849161.2.92137 XP_016859475.1.92137 XP_016859476.1.92137 ENSP00000295057 gi|86990456|ref|NP_849161.2| ENSP00000295057 ENSP00000386646 ENSP00000393562 ENSP00000414523 9606.ENSP00000295057 ENSP00000295057 ENSP00000386646 ENSP00000393562 ENSP00000414523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]