SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|87116681|ref|NP_705841.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|87116681|ref|NP_705841.2|
Domain Number 1 Region: 100-298
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 3.27e-23
Family Glycerol-3-phosphate (1)-acyltransferase 0.027
Further Details:      
 
Weak hits

Sequence:  gi|87116681|ref|NP_705841.2|
Domain Number - Region: 351-416
Classification Level Classification E-value
Superfamily EF-hand 0.00161
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|87116681|ref|NP_705841.2|
Sequence length 524
Comment lysophospholipid acyltransferase LPCAT4 [Homo sapiens]
Sequence
MSQGSPGDWAPLDPTPGPPASPNPFVHELHLSRLQRVKFCLLGALLAPIRVLLAFIVLFL
LWPFAWLQVAGLSEEQLQEPITGWRKTVCHNGVLGLSRLLFFLLGFLRIRVRGQRASRLQ
APVLVAAPHSTFFDPIVLLPCDLPKVVSRAENLSVPVIGALLRFNQAILVSRHDPASRRR
VVEEVRRRATSGGKWPQVLFFPEGTCSNKKALLKFKPGAFIAGVPVQPVLIRYPNSLDTT
SWAWRGPGVLKVLWLTASQPCSIVDVEFLPVYHPSPEESRDPTLYANNVQRVMAQALGIP
ATECEFVGSLPVIVVGRLKVALEPQLWELGKVLRKAGLSAGYVDAGAEPGRSRMISQEEF
ARQLQLSDPQTVAGAFGYFQQDTKGLVDFRDVALALAALDGGRSLEELTRLAFELFAEEQ
AEGPNRLLYKDGFSTILHLLLGSPHPAATALHAELCQAGSSQGLSLCQFQNFSLHDPLYG
KLFSTYLRPPHTSRGTSQTPNASSPGNPTALANGTVQAPKQKGD
Download sequence
Identical sequences Q643R3
NP_705841.2.87134 NP_705841.2.92137 ENSP00000317300 ENSP00000317300 gi|87116681|ref|NP_705841.2| ENSP00000317300 9606.ENSP00000317300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]