SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88758594|ref|NP_005379.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88758594|ref|NP_005379.3|
Domain Number 1 Region: 56-276
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.96e-53
Family Phosducin 0.00000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88758594|ref|NP_005379.3|
Sequence length 301
Comment phosducin-like protein [Homo sapiens]
Sequence
MTTLDDKLLGEKLQYYYSSSEDEDSDHEDKDRGRCAPASSSVPAEAELAGEGISVNTGPK
GVINDWRRFKQLETEQREEQCREMERLIKKLSMTCRSHLDEEEEQQKQKDLQEKISGKMT
LKEFAIMNEDQDDEEFLQQYRKQRMEEMRQQLHKGPQFKQVFEISSGEGFLDMIDKEQKS
IVIMVHIYEDGIPGTEAMNGCMICLAAEYPAVKFCKVKSSVIGASSQFTRNALPALLIYK
GGELIGNFVRVTDQLGDDFFAVDLEAFLQEFGLLPEKEVLVLTSVRNSATCHSEDSDLEI
D
Download sequence
Identical sequences Q13371
gi|88758594|ref|NP_005379.3| ENSP00000259467 NP_005379.3.87134 NP_005379.3.92137 ENSP00000377826 9606.ENSP00000259467 ENSP00000259467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]