SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88758613|ref|NP_036204.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88758613|ref|NP_036204.2|
Domain Number 1 Region: 30-182
Classification Level Classification E-value
Superfamily C-type lectin-like 3.54e-20
Family C-type lectin domain 0.0035
Further Details:      
 
Domain Number 2 Region: 257-385
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000455
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 421-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000547
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 4 Region: 383-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000109
Family EGF-type module 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88758613|ref|NP_036204.2|
Sequence length 652
Comment complement component C1q receptor precursor [Homo sapiens]
Sequence
MATSMGLLLLLLLLLTQPGAGTGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNL
ATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGG
EDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVC
KFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLC
KEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTC
ASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVN
TPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGE
DGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGP
PDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGS
PGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKLLLFYILGTVVAILLLLALA
LGLLVYRKRRAKREEKKEKKPQNAADSYSWVPERAESRAMENQYSPTPGTDC
Download sequence
Identical sequences Q9NPY3
ENSP00000246006 NYSGRC-88758613 ENSP00000246006 ENSP00000246006 9606.ENSP00000246006 NP_036204.2.87134 NP_036204.2.92137 gi|88758613|ref|NP_036204.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]