SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88999583|ref|NP_524147.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88999583|ref|NP_524147.2|
Domain Number 1 Region: 4-149
Classification Level Classification E-value
Superfamily EF-hand 7.85e-38
Family Calmodulin-like 0.000000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88999583|ref|NP_524147.2|
Sequence length 151
Comment myosin light polypeptide 6 isoform 2 [Homo sapiens]
Sequence
MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEM
NVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKM
TEEEVEMLVAGHEDSNGCINYEELVRMVLNG
Download sequence
Identical sequences A0A0G2K6J5 A0A1S3ADI7 A0A1S3FJF2 A0A1U7QV29 A0A250YA84 A0A286XZS1 A0A2F0B3E5 A0A2J8Q1I6 A0A2K5IMY5 A0A2K5NAD9 A0A2K5RZ08 A0A2K6A4X1 F7HNE5 G1TDK0 H2NHN7 Q642K0
NP_001102954.1.100692 NP_001102954.1.4139 NP_034990.1.92730 NP_524147.2.87134 NP_524147.2.92137 XP_001504865.1.31192 XP_003476239.1.53824 XP_003506235.1.69978 XP_003790564.1.62490 XP_004006638.1.66739 XP_004053404.1.27298 XP_004274216.1.21590 XP_004379994.1.4749 XP_004401716.1.74151 XP_004429295.1.5094 XP_004466161.2.11602 XP_004700620.1.18182 XP_004773152.1.14098 XP_004861389.1.39548 XP_005079772.1.91757 XP_005206559.1.76553 XP_005335682.1.77405 XP_005371243.1.66349 XP_005397348.1.28644 XP_005655646.1.46622 XP_005680423.1.57651 XP_005876790.1.60319 XP_005903489.1.15283 XP_006040013.1.26621 XP_006093716.1.53796 XP_006165662.1.99106 XP_006179897.1.101512 XP_006218633.1.17985 XP_006728837.1.47382 XP_006777917.1.95426 XP_006777919.1.95426 XP_006859480.1.41390 XP_006897697.1.29581 XP_006908952.1.64745 XP_007081554.1.5354 XP_007129415.1.24612 XP_007179631.1.59432 XP_007467797.1.90284 XP_007533404.1.11023 XP_007633760.1.28591 XP_007953303.1.48129 XP_008146847.1.99482 XP_008254866.1.1745 XP_008528368.1.77740 XP_008575388.1.73410 XP_008710505.1.72690 XP_008846927.1.79516 XP_008976862.1.60992 XP_009246145.1.23681 XP_010368255.1.97406 XP_010596254.1.64505 XP_010643013.1.5607 XP_010837517.1.44457 XP_010962172.1.22495 XP_010975177.1.51371 XP_011219011.1.58354 XP_011373995.1.92234 XP_011918862.1.92194 XP_011942918.1.92194 XP_012016088.1.54773 XP_012305875.1.9421 XP_012506707.1.63892 XP_012609174.1.48125 XP_012783743.1.84141 XP_012876450.1.60039 XP_014699365.1.49734 XP_014940606.1.86478 XP_015007435.1.72884 XP_015338718.1.40921 XP_015861377.1.50099 XP_016021262.1.101085 XP_016079959.1.3490 XP_016778707.1.37143 XP_017391790.1.71028 XP_017517435.1.32401 XP_017708738.1.44346 XP_017748134.1.44346 XP_019310296.1.44245 XP_019524649.1.44202 XP_019597855.1.88060 XP_019816614.1.53367 XP_020018830.1.5219 XP_020739851.1.74333 XP_021060399.1.100879 XP_021510469.1.76796 XP_021542853.1.83697 XP_531631.3.84170 ENSPANP00000010678 ENSOCUP00000014926 ENSBTAP00000014306 ENSMUSP00000128803 ENSP00000446714 ENSFCAP00000013789 ENSOPRP00000001196 ENSP00000446714 ENSPPYP00000005293 gi|88999583|ref|NP_524147.2| 9600.ENSPPYP00000005293 9606.ENSP00000293422 9685.ENSFCAP00000013789 9823.ENSSSCP00000000402 9823.ENSSSCP00000000411 9986.ENSOCUP00000014926 ENSDNOP00000028004 ENSMUSP00000128803 ENSBTAP00000014304 ENSMUSP00000128803 ENSPPYP00000005293 ENSOCUP00000014926 ENSOPRP00000001196 ENSSSCP00000000402 ENSSSCP00000000411 ENSSSCP00000000402 ENSSSCP00000000411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]