SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|8922333|ref|NP_060519.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|8922333|ref|NP_060519.1|
Domain Number 1 Region: 22-116
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000144
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|8922333|ref|NP_060519.1|
Sequence length 149
Comment pleckstrin homology domain-containing family J member 1 [Homo sapiens]
Sequence
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEPVGALL
LERCRVVREEPGTFSISFIEDPERKYHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRN
EIRKVTGKDPLEQFGISEEARFQLSGLQA
Download sequence
Identical sequences Q9NW61
9606.ENSP00000318075 ENSP00000318075 ENSP00000465391 NP_060519.1.87134 NP_060519.1.92137 GO.33778 hss001002303.1 gi|8922333|ref|NP_060519.1| ENSP00000318075 ENSP00000465391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]