SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|8922644|ref|NP_060675.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|8922644|ref|NP_060675.1|
Domain Number 1 Region: 26-101
Classification Level Classification E-value
Superfamily L domain-like 0.0000286
Family Ngr ectodomain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|8922644|ref|NP_060675.1|
Sequence length 128
Comment leucine-rich repeat-containing protein 20 isoform 3 [Homo sapiens]
Sequence
MLKKMGEAVARVARKVNETVESGSDTLDLAECKLVSFPIGIYKVLRNVSGQIHLITLANN
ELKSLTSKFMTTFSQLRDVPVEKLAAMPALRSINLRFNPLNAEVRVIAPPLIKFDMLMSP
EGARAPLP
Download sequence
Identical sequences A0A024QZR0 A0A2I2ZYD7 K7BEN8
gi|8922644|ref|NP_060675.1| HR995 ENSP00000350255 ENSP00000378457 NP_060675.1.87134 NP_060675.1.92137 XP_001171096.1.37143 ENSP00000350255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]