SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|8922946|ref|NP_060833.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|8922946|ref|NP_060833.1|
Domain Number 1 Region: 2-209
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.98e-18
Family FAD-linked reductases, N-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|8922946|ref|NP_060833.1|
Sequence length 315
Comment renalase isoform 2 [Homo sapiens]
Sequence
MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKAEDSGGRMTTACSPHNPQCTADLGA
QYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLK
ESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISEC
QRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGP
SLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVPSAGVIL
GCAKSPWMMAIGFPI
Download sequence
Identical sequences NP_060833.1.87134 NP_060833.1.92137 XP_011538226.1.92137 XP_016871869.1.92137 ENSP00000361015 ENSP00000361015 gi|8922946|ref|NP_060833.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]