SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|8923173|ref|NP_060170.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|8923173|ref|NP_060170.1|
Domain Number 1 Region: 80-217
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-29
Family DBL homology domain (DH-domain) 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|8923173|ref|NP_060170.1|
Sequence length 219
Comment rho guanine nucleotide exchange factor 38 isoform 2 [Homo sapiens]
Sequence
MEPKEATGKENMVTKKKNLAFLRSRLYMLERRKTDTVVESSVSGDHSGTLRRSQSDRTEY
NQKLQEKMTPQGECSVAETLTPEEEHHMKRMMAKREKIIKELIQTEKDYLNDLELCVREV
VQPLRNKKTDRLDVDSLFSNIESVHQISAKLLSLLEEATTDVEPAMQVIGEVFLQIKGPL
EDIYKIYCYHHDEAHSILESYEKEEELKEHLSHCIQSLK
Download sequence
Identical sequences ENSP00000265154 9606.ENSP00000265154 gi|8923173|ref|NP_060170.1| NP_060170.1.87134 NP_060170.1.92137 ENSP00000265154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]