SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|89363026|ref|NP_056232.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89363026|ref|NP_056232.2|
Domain Number 1 Region: 6-83
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000301
Family Calponin-homology domain, CH-domain 0.0051
Further Details:      
 
Weak hits

Sequence:  gi|89363026|ref|NP_056232.2|
Domain Number - Region: 197-232
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0288
Family Trimerization domain of TRAF 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|89363026|ref|NP_056232.2|
Sequence length 236
Comment sperm flagellar protein 1 [Homo sapiens]
Sequence
MASSVDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAEVIKFYFPKMVEMHNYVPAN
SLQQKLSNWGHLNRKVLKRLNFSVPDDVMRKIAQCAPGVVELVLIPLRQRLEERQRRRKQ
GAGSLQELAPQDGSGYMDVGVSQKARGEGVPDPQGGGQLSWDRPPAPRPPAYNRALQGDP
SFVLQIAEKEQELLASQETVQVLQMKVRRLEHLLQLKNVRIEDLSRRLQQAERKQR
Download sequence
Identical sequences G3QSQ8 Q9Y4P9
9606.ENSP00000369080 ENSP00000369080 gi|89363026|ref|NP_056232.2| ENSP00000369080 NP_056232.2.87134 NP_056232.2.92137 XP_004061789.1.27298 ENSGGOP00000005703 ENSGGOP00000005703 ENSP00000369080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]