SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|92091600|ref|NP_001035207.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|92091600|ref|NP_001035207.1|
Domain Number 1 Region: 966-1143
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 535-651
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.4e-33
Family Pyk2-associated protein beta ARF-GAP domain 0.001
Further Details:      
 
Domain Number 3 Region: 188-212,286-419
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-28
Family Pleckstrin-homology domain (PH domain) 0.00091
Further Details:      
 
Domain Number 4 Region: 677-848
Classification Level Classification E-value
Superfamily PH domain-like 2e-26
Family Pleckstrin-homology domain (PH domain) 0.0045
Further Details:      
 
Domain Number 5 Region: 9-64
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000628
Family SAM (sterile alpha motif) domain 0.0094
Further Details:      
 
Domain Number 6 Region: 1277-1432
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000134
Family Pleckstrin-homology domain (PH domain) 0.042
Further Details:      
 
Domain Number 7 Region: 442-536
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000604
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 8 Region: 863-991
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000308
Family Pleckstrin-homology domain (PH domain) 0.0098
Further Details:      
 
Weak hits

Sequence:  gi|92091600|ref|NP_001035207.1|
Domain Number - Region: 1178-1262
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00108
Family Ras-binding domain, RBD 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|92091600|ref|NP_001035207.1|
Sequence length 1450
Comment arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 isoform c [Homo sapiens]
Sequence
MAEAGDAALSVAEWLRALHLEQYTGLFEQHGLVWATECQGLSDTRLMDMGMLLPGHRRRI
LAGLLRAHTSPAPAPRPTPRPVPMKRHIFRSPPVPATPPEPLPTTTEDEGLPAAPPIPPR
RSCLPPTCFTTPSTAAPDPVLPPLPAKRHLAELSVPPVPPRTGPPRLLVSLPTKEEESLL
PSLSSPPQPQSEEPLSTLPQGPPQPPSPPPCPPEIPPKPVRLFPEFDDSDYDEVPEEGPG
APARVMTKKEEPPPSRVPRAVRVASLLSEGEELSGDDQGDEEEDDHAYEGVPNGGWHTSS
LSLSLPSTIAAPHPMDGPPGGSTPVTPVIKAGWLDKNPPQGSYIYQKRWVRLDTDHLRYF
DSNKDAYSKRFISVACISHVAAIGDQKFEVITNNRTFAFRAESDVERKEWMQALQQAMAE
QRARARLSSAYLLGVPGSEQPDRAGSLELRGFKNKLYVAVVGDKVQLYKNLEEYHLGIGI
TFIDMSVGNVKEVDRRSFDLTTPYRIFSFSADSELEKEQWLEAMQGAIAEALSTSEVAER
IWAAAPNRFCADCGAPQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTET
LIELFLQLGNGAGNRFWAANVPPSEALQPSSSPSTRRCHLEAKYREGKYRRYHPLFGNQE
ELDKALCAAVTTTDLAETQALLGCGAGINCFSGDPEAPTPLALAEQAGQTLQMEFLRNNR
TTEVPRLDSMKPLEKHYSVVLPTVSHSGFLYKTASAGKLLQDRRAREEFSRRWCVLGDGV
LSYFENERAVTPNGEIRASEIVCLAVPPPDTHGFEHTFEVYTEGERLYLFGLESAEQAHE
WVKCIAKAFVPPLAEDLLARDFERLGRLPYKAGLSLQRAQEGWFSLSGSELRAVFPEGPC
EEPLQLRKLQELSIQGDSENQVLVLVERRRTLYIQGERRLDFMGWLGAIQKAAASMGDTL
SEQQLGDSDIPVIVYRCVDYITQCGLTSEGIYRKCGQTSKTQRLLESLRQDARSVHLKEG
EQHVDDVSSALKRFLRDLPDGLFTRAQRLTWLEASEIEDEEEKVSRYRELLVRLPPVNRA
TVKALISHLYCVQCFSDTNQMNVHNLAIVFGPTLFQTDGQDYKAGRVVEDLINHYVVVFS
VDEEELRKQREEITAIVKMRVAGTASGTQHAGDFICTVYLEEKKAETEQHIKVPASMTAE
ELTLEILDRRNVGIREKDYWTCFEVNEREEAERPLHFAEKVLPILHGLGTDSHLVVKKHQ
AMEAMLLYLASRVGDTKHGMMKFREDRSLLGLGLPSGGFHDRYFILNSSCLRLYKEVRSQ
RPWSGAPETSHRPEKEWPIKSLKVYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCDT
QMELREWFATFLFVQHDGLVWPSEPSRVSRAVPEVRLGSVSLIPLRGSENEMRRSVAAFT
ADPLSLLRNV
Download sequence
Identical sequences Q96P48
gi|92091600|ref|NP_001035207.1| ENSP00000335506 ENSP00000377233 ENSP00000377233 NP_001035207.1.87134 NP_001035207.1.92137 9606.ENSP00000377233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]