SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|93102364|ref|NP_055870.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|93102364|ref|NP_055870.2|
Domain Number 1 Region: 114-305
Classification Level Classification E-value
Superfamily PH domain-like 1.75e-40
Family Pleckstrin-homology domain (PH domain) 0.0088
Further Details:      
 
Domain Number 2 Region: 3-73
Classification Level Classification E-value
Superfamily EF-hand 0.0000000821
Family Calmodulin-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|93102364|ref|NP_055870.2|
Sequence length 585
Comment switch-associated protein 70 [Homo sapiens]
Sequence
MGSLKEELLKAIWHAFTALDQDHSGKVSKSQLKVLSHNLCTVLKVPHDPVALEEHFRDDD
EGPVSNQGYMPYLNRFILEKVQDNFDKIEFNRMCWTLCVKKNLTKNPLLITEEDAFKIWV
IFNFLSEDKYPLIIVSEEIEYLLKKLTEAMGGGWQQEQFEHYKINFDDSKNGLSAWELIE
LIGNGQFSKGMDRQTVSMAINEVFNELILDVLKQGYMMKKGHRRKNWTERWFVLKPNIIS
YYVSEDLKDKKGDILLDENCCVESLPDKDGKKCLFLVKCFDKTFEISASDKKKKQEWIQA
IHSTIHLLKLGSPPPHKEARQRRKELRKKQLAEQEELERQMKELQAANESKQQELEAVRK
KLEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVR
ELEDMYLKLQEALEDERQARQDEETVRKLQARLLEEESSKRAELEKWHLEQQQAIQTTEA
EKQELENQRVLKEQALQEAMEQLEQLELERKQALEQYEEVKKKLEMATNKTKSWKDKVAH
HEGLIRLIEPGSKNPHLITNWGPAAFTEAELEEREKNWKEKKTTE
Download sequence
Identical sequences K7A814 Q9UH65
ENSP00000315630 ENSP00000315630 9598.ENSPTRP00000042623 9606.ENSP00000315630 ENSP00000399056 NP_055870.2.87134 NP_055870.2.92137 XP_508279.3.37143 gi|93102364|ref|NP_055870.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]