SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94721308|ref|NP_116281.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94721308|ref|NP_116281.2|
Domain Number 1 Region: 203-345
Classification Level Classification E-value
Superfamily PH domain-like 2.55e-36
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 2 Region: 100-205
Classification Level Classification E-value
Superfamily Second domain of FERM 4.58e-32
Family Second domain of FERM 0.0001
Further Details:      
 
Domain Number 3 Region: 18-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-27
Family First domain of FERM 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94721308|ref|NP_116281.2|
Sequence length 570
Comment FERM domain-containing protein 5 isoform 2 [Homo sapiens]
Sequence
MLSRLMSGSSRSLEREYSCTVRLLDDSEYTCTIQRDAKGQYLFDLLCHHLNLLEKDYFGI
RFVDPDKQRHWLEFTKSVVKQLRSQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRD
LYHGRLLCKTSDAALLAAYILQAEIGDYDSGKHPEGYSSKFQFFPKHSEKLERKIAEIHK
TELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHF
IKWNEVTKLKFEGKTFYLYVSQKEEKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSS
QVRTVSSSNLFFKGSRFRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSRSCPSITHGPR
LSSVPRTRRRAVHISIMEGLESLRDSAHSTPVRSTSHGDTFLPHVRSSRTDSNERVAVIA
DEAYSPADSVLPTPVAEHSLELMLLSRQINGATCSIEEEKESEASTPTATEVEALGGELR
ALCQGHSGPEEEQVNKFVLSVLRLLLVTMGLLFVLLLLLIILTESDLDIAFFRDIRQTPE
FEQFHYQYFCPLRRWFACKIRSVVSLLIDT
Download sequence
Identical sequences G3RLI5 H2Q9B7 Q7Z6J6
gi|94721308|ref|NP_116281.2| NP_116281.2.87134 NP_116281.2.92137 XP_003815008.1.60992 XP_004056144.1.27298 XP_510360.2.37143 ENSP00000403067 ENSP00000403067 9598.ENSPTRP00000011978 9606.ENSP00000403067 HR5614 HR6170 ENSP00000384142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]