SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94966757|ref|NP_006840.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94966757|ref|NP_006840.2|
Domain Number 1 Region: 40-152
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.23e-30
Family PDI-like 0.00018
Further Details:      
 
Domain Number 2 Region: 376-495
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.7e-29
Family PDI-like 0.0019
Further Details:      
 
Domain Number 3 Region: 253-386
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.49e-22
Family PDI-like 0.035
Further Details:      
 
Domain Number 4 Region: 162-266
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000313
Family PDI-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94966757|ref|NP_006840.2|
Sequence length 525
Comment protein disulfide-isomerase A2 precursor [Homo sapiens]
Sequence
MSRQLLPVLLLLLLRASCPWGQEQGARSPSEEPPEEEIPKEDGILVLSRHTLGLALREHP
ALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMVVTLAKVDGPAQRELAEEFGVTEYPTL
KFFRNGNRTHPEEYTGPRDAEGIAEWLRRRVGPSAMRLEDEAAAQALIGGRDLVVIGFFQ
DLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTVVLFKKFDEGRADFPVDEEL
GLDLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEA
APRFRGQVLFVVVDVAADNEHVLQYFGLKAEAAPTLRLVNLETTKKYAPVDGGPVTAASI
TAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTH
CKEMAPAWEALAEKYQDHEDIIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKS
TRDLETFSKFLDNGGVLPTEEPPEEPAAPFPEPPANSTMGSKEEL
Download sequence
Identical sequences Q13087
gi|94966757|ref|NP_006840.2| 9606.ENSP00000219406 ENSP00000219406 ENSP00000219406 ENSP00000219406 NP_006840.2.87134 NP_006840.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]