SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|9506545|ref|NP_061947.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|9506545|ref|NP_061947.1|
Domain Number 1 Region: 325-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000428
Family EGF-type module 0.005
Further Details:      
 
Domain Number 2 Region: 389-518
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000847
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 287-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  gi|9506545|ref|NP_061947.1|
Domain Number - Region: 252-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0528
Family Integrin beta EGF-like domains 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|9506545|ref|NP_061947.1|
Sequence length 685
Comment delta-like protein 4 precursor [Homo sapiens]
Sequence
MAAASRSASGWALLLLVALWQQRAAGSGVFQLQLQEFINERGVLASGRPCEPGCRTFFRV
CLKHFQAVVSPGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE
AWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYY
GDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECL
CRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATC
SNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDGYHCLCPPGYYGLHCE
HSTLSCADSPCFNGGSCRERNQGANYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNR
GPSRMCRCRPGFTGTYCELHVSDCARNPCAHGGTCHDLENGLMCTCPAGFSGRRCEVRTS
IDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLAV
LLVLLGMVAVAVRQLRLRRPDDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGL
DKSNCGKQQNHTLDYNLAPGPLGRGTMPGKFPHSDKSLGEKAPLRLHSEKPECRISAICS
PRDSMYQSVCLISEERNECVIATEV
Download sequence
Identical sequences Q9NR61
NP_061947.1.87134 NP_061947.1.92137 ENSP00000249749 gi|9506545|ref|NP_061947.1| ENSP00000249749 ENSP00000249749 9606.ENSP00000249749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]