SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|9507163|ref|NP_061840.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|9507163|ref|NP_061840.1|
Domain Number 1 Region: 47-137
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-24
Family PDZ domain 0.002
Further Details:      
 
Domain Number 2 Region: 181-264
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000402
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 279-389
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000724
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|9507163|ref|NP_061840.1|
Sequence length 517
Comment gamma-1-syntrophin [Homo sapiens]
Sequence
MDFRTACEETKTGICLLQDGNQEPFKVRLHLAKDILMIQEQDVICVSGEPFYSGERTVTI
RRQTVGGFGLSIKGGAEHNIPVVVSKISKEQRAELSGLLFIGDAILQINGINVRKCRHEE
VVQVLRNAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHP
NNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRFSQYVPGTDLSRQNAFQVIAVDGVC
TGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQD
RVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVYEIMCKILKDSDLLDRRKQCFTV
QSESGEDLYFSVELESDLAQWERAFQTATFLEVERIQCKTYACVLESHLMGLTIDFSTGF
ICFDAATKAVLWRYKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIH
SFFAAKVACLDPLFLGNQATASTAASSATTSKAKYTT
Download sequence
Identical sequences A0A024R7Y0 Q9NSN8
ENSP00000429276 ENSP00000429842 ENSP00000483474 NP_001274742.1.87134 NP_001274742.1.92137 NP_001308702.1.87134 NP_001308702.1.92137 NP_061840.1.87134 NP_061840.1.92137 XP_016869068.1.92137 XP_016869069.1.92137 9606.ENSP00000342804 ENSP00000429276 ENSP00000429842 ENSP00000276467 gi|9507163|ref|NP_061840.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]