SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|95113664|ref|NP_060684.4| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|95113664|ref|NP_060684.4|
Domain Number 1 Region: 5-261
Classification Level Classification E-value
Superfamily L domain-like 4e-50
Family Internalin LRR domain 0.03
Further Details:      
 
Domain Number 2 Region: 190-393
Classification Level Classification E-value
Superfamily L domain-like 1.55e-36
Family Internalin LRR domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|95113664|ref|NP_060684.4|
Sequence length 524
Comment leucine-rich repeat-containing protein 1 [Homo sapiens]
Sequence
MFHCIPLWRCNRHVESIDKRHCSLVYVPEEIYRYARSLEELLLDANQLRELPEQFFQLVK
LRKLGLSDNEIQRLPPEIANFMQLVELDVSRNEIPEIPESISFCKALQVADFSGNPLTRL
PESFPELQNLTCLSVNDISLQSLPENIGNLYNLASLELRENLLTYLPDSLTQLRRLEELD
LGNNEIYNLPESIGALLHLKDLWLDGNQLSELPQEIGNLKNLLCLDVSENRLERLPEEIS
GLTSLTDLVISQNLLETIPDGIGKLKKLSILKVDQNRLTQLPEAVGECESLTELVLTENQ
LLTLPKSIGKLKKLSNLNADRNKLVSLPKEIGGCCSLTVFCVRDNRLTRIPAEVSQATEL
HVLDVAGNRLLHLPLSLTALKLKALWLSDNQSQPLLTFQTDTDYTTGEKILTCVLLPQLP
SEPTCQENLPRCGALENLVNDVSDEAWNERAVNRVSAIRFVEDEKDEEDNETRTLLRRAT
PHPGELKHMKKTVENLRNDMNAAKGLDSNKNEVNHAIDRVTTSV
Download sequence
Identical sequences Q9BTT6
ENSP00000359919 9606.ENSP00000359925 ENSP00000359925 ENSP00000359925 NP_060684.4.87134 NP_060684.4.92137 XP_011513028.1.92137 gi|95113664|ref|NP_060684.4| NYSGXRC-13122a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]