SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|95147536|ref|NP_573418.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|95147536|ref|NP_573418.2|
Domain Number 1 Region: 280-418
Classification Level Classification E-value
Superfamily PH domain-like 4.78e-31
Family Phosphotyrosine-binding domain (PTB) 0.0000763
Further Details:      
 
Domain Number 2 Region: 105-256
Classification Level Classification E-value
Superfamily PH domain-like 2.73e-28
Family Phosphotyrosine-binding domain (PTB) 0.02
Further Details:      
 
Domain Number 3 Region: 31-55
Classification Level Classification E-value
Superfamily WW domain 0.000000000371
Family WW domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|95147536|ref|NP_573418.2|
Sequence length 491
Comment amyloid beta A4 precursor protein-binding family B member 3 isoform c [Homo sapiens]
Sequence
MLGKDYMLAIILVNCDDDLWGDHSLEVEAGLPPGWRKIHDAAGTYYWHVPSGSTQWQRPT
WELGDAEDPGTGTEGIWGLRPPKGRSFSSLESSLDRSNSLSWYGGESYIQSMEPGAKCFA
VRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSRSQPPDGAWGEGQNMLMILKKDAMS
LVNPLDHSLIHCQPLVHIRVWGVGSSKGRPISAPARDFAFVASDKDSCMLKCHVFCCDVP
AKAIASALHGLCAQILSERVEVSGDASCCSPDPISPEDLPRQVELLDAVSQAAQKYEALY
MGTLPVTKAMGMDVLNEAIGTLTARGDRNAWVPTMLSVSDSLMTAHPIQAEASTEEEPLW
QCPVRLVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQPHAGGLSEAVQAACMVQYQKCL
VASAARGKAWGAQARARLRLKRTSSMDSPGGPLPLPLLKGGVGGAGATPRKRGVFSFLDA
FRLKPSLLHMP
Download sequence
Identical sequences NP_573418.2.87134 NP_573418.2.92137 ENSP00000349177 ENSP00000349177 gi|95147536|ref|NP_573418.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]