SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|95147538|ref|NP_006042.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|95147538|ref|NP_006042.3|
Domain Number 1 Region: 282-420
Classification Level Classification E-value
Superfamily PH domain-like 4.78e-31
Family Phosphotyrosine-binding domain (PTB) 0.0000763
Further Details:      
 
Domain Number 2 Region: 105-258
Classification Level Classification E-value
Superfamily PH domain-like 4.51e-28
Family Phosphotyrosine-binding domain (PTB) 0.014
Further Details:      
 
Domain Number 3 Region: 31-55
Classification Level Classification E-value
Superfamily WW domain 0.000000000371
Family WW domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|95147538|ref|NP_006042.3|
Sequence length 493
Comment amyloid beta A4 precursor protein-binding family B member 3 isoform d [Homo sapiens]
Sequence
MLGKDYMLAIILVNCDDDLWGDHSLEVEAGLPPGWRKIHDAAGTYYWHVPSGSTQWQRPT
WELGDAEDPGTGTEGIWGLRPPKGRSFSSLESSLDRSNSLSWYGGESYIQSMEPGAKCFA
VRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSRSQPPDGAWGEGQNMLMILKKDAMS
LVNPLDHSLIHCQPLVHIRVWGVGSSKGRDSPISAPARDFAFVASDKDSCMLKCHVFCCD
VPAKAIASALHGLCAQILSERVEVSGDASCCSPDPISPEDLPRQVELLDAVSQAAQKYEA
LYMGTLPVTKAMGMDVLNEAIGTLTARGDRNAWVPTMLSVSDSLMTAHPIQAEASTEEEP
LWQCPVRLVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQPHAGGLSEAVQAACMVQYQK
CLVASAARGKAWGAQARARLRLKRTSSMDSPGGPLPLPLLKGGVGGAGATPRKRGVFSFL
DAFRLKPSLLHMP
Download sequence
Identical sequences 9606.ENSP00000346378 ENSP00000346378 ENSP00000351389 NP_006042.3.87134 NP_006042.3.92137 gi|95147538|ref|NP_006042.3| ENSP00000346378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]