SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|95147540|ref|NP_573419.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|95147540|ref|NP_573419.2|
Domain Number 1 Region: 275-413
Classification Level Classification E-value
Superfamily PH domain-like 4.65e-31
Family Phosphotyrosine-binding domain (PTB) 0.0000763
Further Details:      
 
Domain Number 2 Region: 105-251
Classification Level Classification E-value
Superfamily PH domain-like 9.47e-30
Family Phosphotyrosine-binding domain (PTB) 0.025
Further Details:      
 
Domain Number 3 Region: 31-55
Classification Level Classification E-value
Superfamily WW domain 0.000000000371
Family WW domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|95147540|ref|NP_573419.2|
Sequence length 486
Comment amyloid beta A4 precursor protein-binding family B member 3 isoform b [Homo sapiens]
Sequence
MLGKDYMLAIILVNCDDDLWGDHSLEVEAGLPPGWRKIHDAAGTYYWHVPSGSTQWQRPT
WELGDAEDPGTGTEGIWGLRPPKGRSFSSLESSLDRSNSLSWYGGESYIQSMEPGAKCFA
VRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSRSQPPDGAWGEGQNMLMILKKDAMS
LVNPLDHSLIHCQPLVHIRVWGVGSSKGRDRDFAFVASDKDSCMLKCHVFCCDVPAKAIA
SALHGLCAQILSERVEVSGDASCCSPDPISPEDLPRQVELLDAVSQAAQKYEALYMGTLP
VTKAMGMDVLNEAIGTLTARGDRNAWVPTMLSVSDSLMTAHPIQAEASTEEEPLWQCPVR
LVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQPHAGGLSEAVQAACMVQYQKCLVASAA
RGKAWGAQARARLRLKRTSSMDSPGGPLPLPLLKGGVGGAGATPRKRGVFSFLDAFRLKP
SLLHMP
Download sequence
Identical sequences O95704
ENSP00000350171 NP_573419.2.87134 NP_573419.2.92137 ENSP00000350171 gi|95147540|ref|NP_573419.2| hsk003002479.2 hsk003002479.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]