SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|9966829|ref|NP_065091.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|9966829|ref|NP_065091.1|
Domain Number 1 Region: 279-450
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-43
Family SPRY domain 0.0002
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily RING/U-box 1.56e-16
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Domain Number 3 Region: 85-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000504
Family B-box zinc-binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  gi|9966829|ref|NP_065091.1|
Domain Number - Region: 178-244
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00648
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|9966829|ref|NP_065091.1|
Sequence length 452
Comment tripartite motif-containing protein 49 [Homo sapiens]
Sequence
MNSGILQVFQGELICPLCMNYFIDPVTIDCGHSFCRPCFYLNWQDIPFLVQCSECTKSTE
QINLKTNIHLKKMASLARKVSLWLFLSSEEQMCGTHRETKKIFCEVDRSLLCLLCSSSQE
HRYHRHRPIEWAAEEHREKLLQKMQSLWEKACENHRNLNVETTRTRCWKDYVNLRLEAIR
AEYQKMPAFHHEEEKHNLEMLKKKGKEIFHRLHLSKAKMAHRMEILRGMYEELNEMCHKP
DVELLQAFGDILHRSESVLLHMPQPLNPELSAGPITGLRDRLNQFRVHITLHHEEANNDI
FLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTFTSGKYYWEVHVGDSWNWAFGVCNM
YRKEKNQNEKIDGKAGLFLLGCVKNDIQCSLFTTSPLMLQYIPKPTSRVGLFLDCEAKTV
SFVDVNQSSLIYTIPNCSFSPPLRPIFCCIHF
Download sequence
Identical sequences P0CI25
9606.ENSP00000327604 gi|9966829|ref|NP_065091.1| ENSP00000327604 ENSP00000327604 NP_065091.1.87134 NP_065091.1.92137 ENSP00000327604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]