SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|100913189|ref|NP_077747.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|100913189|ref|NP_077747.1|
Domain Number 1 Region: 17-175
Classification Level Classification E-value
Superfamily CBS-domain pair 5.94e-42
Family CBS-domain pair 0.000000158
Further Details:      
 
Domain Number 2 Region: 179-316
Classification Level Classification E-value
Superfamily CBS-domain pair 1.18e-31
Family CBS-domain pair 0.00000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|100913189|ref|NP_077747.1|
Sequence length 328
Comment 5'-AMP-activated protein kinase subunit gamma-2 isoform b [Homo sapiens]
Sequence
MLEKLEFEDEAVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGV
RAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPL
VNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAFM
KQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVINL
AAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADSI
VGIISLSDILQALILTPAGAKQKETETE
Download sequence
Identical sequences A0A2J8JZE9 A0A2J8RKG8 G1QX87
gi|100913189|ref|NP_077747.1| ENSP00000387386 ENSP00000387386 GO.33862 NP_001291460.1.87134 NP_001291460.1.92137 NP_077747.1.87134 NP_077747.1.92137 XP_012367764.1.23891 XP_016801409.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]