SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|115430237|ref|NP_066022.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|115430237|ref|NP_066022.2|
Domain Number 1 Region: 50-286
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.34e-90
Family Calponin-homology domain, CH-domain 0.00000243
Further Details:      
 
Domain Number 2 Region: 2409-2525
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-31
Family Pleckstrin-homology domain (PH domain) 0.00012
Further Details:      
 
Domain Number 3 Region: 303-423
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-29
Family Spectrin repeat 0.00018
Further Details:      
 
Domain Number 4 Region: 1569-1725
Classification Level Classification E-value
Superfamily Spectrin repeat 2.25e-29
Family Spectrin repeat 0.00095
Further Details:      
 
Domain Number 5 Region: 849-982
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-23
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 6 Region: 432-534
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-22
Family Spectrin repeat 0.00057
Further Details:      
 
Domain Number 7 Region: 1890-2046
Classification Level Classification E-value
Superfamily Spectrin repeat 3e-22
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 8 Region: 1782-1934
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-21
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 9 Region: 1254-1406
Classification Level Classification E-value
Superfamily Spectrin repeat 4.05e-20
Family Spectrin repeat 0.00084
Further Details:      
 
Domain Number 10 Region: 536-642
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-17
Family Spectrin repeat 0.00098
Further Details:      
 
Domain Number 11 Region: 745-839
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-16
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 12 Region: 1087-1204
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000216
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 13 Region: 603-729
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000929
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 14 Region: 1406-1519
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000173
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 15 Region: 2048-2110
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000036
Family Spectrin repeat 0.0024
Further Details:      
 
Weak hits

Sequence:  gi|115430237|ref|NP_066022.2|
Domain Number - Region: 997-1081
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0024
Family Spectrin repeat 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|115430237|ref|NP_066022.2|
Sequence length 2564
Comment spectrin beta chain, brain 3 isoform sigma1 [Homo sapiens]
Sequence
MAQVPGEVDNMEGLPAPNNNPAARWESPDRGWEREQPAASTAAASLFECSRIKALADERE
AVQKKTFTKWVNSHLARVGCHIGDLYVDLRDGFVLTRLLEVLSGEQLPRPTRGRMRIHSL
ENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIILRFQIQVIKIETEDNRETR
SAKDALLLWCQMKTAGYPEVNIQNFTTSWRDGLAFNALIHRHRPDLVDFSKLTKSNANYN
LQRAFRTAEQHLGLARLLDPEDVNMEAPDEKSIITYVVSFYHYFSKMKALAVEGKRIGKV
LDQVLEVGKIIERYEELAAELLAWIHRTVGLISNQKFANSLSGVQQQLQAFTAYCTLEKP
VKFQEKGNLEVLLFSIQSKLRACNRRLFVPREGCGIWDIDKAWGELEKAEHEREAALRAE
LIRQEKLELLAQRFDHKVAMRESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADIAA
YEERVQGVAELAQALAAEGYYDIRRVAAQRDSVLRQWALLTGLVGARRTRLEQNLALQKV
FQEMVYMVDWMEEMQAQLLSRECGQHLVEADDLLQKHGLLEGDIAAQSERVEALNAAALR
FSQLQGYQPCDPQVICNRVNHVHGCLAELQEQAARRRAELEASRSLWALLQELEEAESWA
RDKERLLEAAGGGGAAGAAGAAGTAGGAHDLSSTARLLAQHKILQGELGGRRALLQQALR
CGEELVAAGGAVGPGADTVHLVGLAERAASARRRWQRLEEAAARRERRLQEARALHQFGA
DLDGLLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGEVEAHRGPVSGLRRQLATLG
GASGAGPLVVALQVRVVEAEQLFAEVTEVAALRRQWLRDALAVYRMFGEVHACELWIGEK
EQWLLSMRVPDSLDDVEVVQHRFESLDQEMNSLMGRVLDVNHTVQELVEGGHPSSDEVRS
CQDHLNSRWNRIVELVEQRKEEMSAVLLVENHVLEVAEVRAQVREKRRAVESAPRAGGAL
QWRLSGLEAALQALEPRQAALLEEAALLAERFPAQAARLHQGAEELGAEWGALASAAQAC
GEAVAAAGRLQRFLHDLDAFLDWLVRAQEAAGGSEGPLPNSLEEADALLARHAALKEEVD
QREEDYARIVAASEALLAADGAELGPGLALDEWLPHLELGWHKLLGLWEARREALVQAHI
YQLFLRDLRQALVVLRNQEMALSGAELPGTVESVEEALKQHRDFLTTMELSQQKMQVAVQ
AAEGLLRQGNIYGEQAQEAVTRLLEKNQENQLRAQQWMQKLHDQLELQHFLRDCHELDGW
IHEKMLMARDGTREDNHKLHKRWLRHQAFMAELAQNKEWLEKIEREGQQLMQEKPELAAS
VRKKLGEIRQCWAELESTTQAKARQLFEASKADQLVQSFAELDKKLLHMESQLQDVDPGG
DLATVNSQLKKLQSMESQVEEWYREVGELQAQTAALPLEPASKELVGERQNAVGERLVRL
LEPLQERRRLLLASKELHQVAHDLDDELAWVQERLPLAMQTERGNGLQAVQQHIKKNQGL
RREIQAHGPRLEEVLERAGALASLRSPEAEAVRRGLEQLQSAWAGLREAAERRQQVLDAA
FQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGVENYEESIAQL
SRQCRALLEMGHPDSEQISRRQSQVDRLYVALKELGEERRVALEQQYWLYQLSRQVSELE
HWIAEKEVVAGSPELGQDFEHVSVLQEKFSEFASETGMAGRERLAAVNQMVDELIECGHT
AAATMAEWKDGLNEAWAELLELMGTRAQLLAASRELHKFFSDARELQGQIEEKRRRLPRL
TTPPEPRPSASSMQRTLRAFEHDLQLLVSQVRQLQEGAAQLRTVYAGEHAEAIASREQEV
LQGWKELLSACEDARLHVSSTADALRFHSQVRDLLSWMDGIASQIGAADKPRDVSSVEVL
MNYHQGLKTELEARVPELTTCQELGRSLLLNKSAMADEIQAQLDKLGTRKEEVSEKWDRH
WEWLQQMLEVHQFAQEAVVADAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAFRKAAAAW
EERFSSLRRLTTIEKIKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYERGLEPL
ARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRLPEIPGRVEPAALPAAPEDAAETPAT
PAAAEQVRPRPERQESADRAEELPRRRRPERQESVDQSEEAARRRRPERQESAEHEAAHS
LTLGRYEQMERRRERRERRLERQESSEQEMPIRGDLVKGKATLADIVEQLQEKEAGPGLP
AGPSLPQPRELPPGRLPNGLELPERTPRPDRPRARDRPKPRRRPRPREGGEGGGSRRSRS
APAQGGSAPAPPPPPTHTVQHEGFLLRKRELDANRKSSNRSWVSLYCVLSKGELGFYKDS
KGPASGSTHGGEPLLSLHKATSEVASDYKKKKHVFKLQTQDGSEFLLQAKDEEEMNGWLE
AVASSVAEHAEIARWGQTLPTTSSTDEGNPKREGGDRRASGRRK
Download sequence
Identical sequences Q9H254
ENSP00000263373 ENSP00000469242 ENSP00000263373 ENSP00000469242 gi|115430237|ref|NP_066022.2| NP_066022.2.87134 NP_066022.2.92137 XP_016882538.1.92137 ENSP00000263373 9606.ENSP00000263373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]