SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|120659782|ref|NP_001073349.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|120659782|ref|NP_001073349.1|
Domain Number 1 Region: 554-817
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-80
Family Protein kinases, catalytic subunit 0.0000204
Further Details:      
 
Domain Number 2 Region: 399-509
Classification Level Classification E-value
Superfamily PH domain-like 5.06e-36
Family Pleckstrin-homology domain (PH domain) 0.000000569
Further Details:      
 
Domain Number 3 Region: 117-190
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.24e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.001
Further Details:      
 
Domain Number 4 Region: 258-315
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.37e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|120659782|ref|NP_001073349.1|
Sequence length 878
Comment serine/threonine-protein kinase D2 isoform A [Homo sapiens]
Sequence
MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLL
PAASELAHVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDL
VEVVLSASATFEDFQIRPHALTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRC
AFSIPNNCSGARKRRLSSTSLASGHSVRLGTSESLPCTAEELSRSTTELLPRRPPSSSSS
SSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCKF
NCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALMDESEDSGVIPGSHSENALH
ASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWR
LDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGE
MPGGTPGGPSGQGAEAARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQ
ENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVA
ILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLITQILV
ALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAP
EVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPASPWSHISAGA
IDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWEQF
AAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL
Download sequence
Identical sequences Q9BZL6
ENSP00000291281 ENSP00000393978 gi|120659782|ref|NP_001073349.1| gi|120659785|ref|NP_001073350.1| gi|19923468|ref|NP_057541.2| NP_001073349.1.87134 NP_001073349.1.92137 NP_001073350.1.87134 NP_001073350.1.92137 NP_057541.2.87134 NP_057541.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]