SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167614506|ref|NP_002289.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167614506|ref|NP_002289.2|
Domain Number 1 Region: 118-620
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.91e-161
Family Calponin-homology domain, CH-domain 0.00000000272
Further Details:      
 
Domain Number 2 Region: 4-93
Classification Level Classification E-value
Superfamily EF-hand 3.04e-18
Family Calmodulin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167614506|ref|NP_002289.2|
Sequence length 627
Comment plastin-2 [Homo sapiens]
Sequence
MARGSVSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVREITENLMAT
GDLDQDGRISFDEFIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSE
EEKYAFVNWINKALENDPDCRHVIPMNPNTNDLFNAVGDGIVLCKMINLSVPDTIDERTI
NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADI
ELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCNKIGNFSTDIKDSKAYY
HLLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGNP
KLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDL
SDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIGG
QDLNEGNRTLTLALIWQLMRRYTLNILEEIGGGQKVNDDIIVNWVNETLREAKKSSSISS
FKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYAL
PEDLVEVNPKMVMTVFACLMGKGMKRV
Download sequence
Identical sequences A0A024RDT4 P13796
gi|167614506|ref|NP_002289.2| NP_002289.2.87134 NP_002289.2.92137 XP_005266431.1.92137 ENSP00000315757 ENSP00000315757 ENSP00000381581 9606.ENSP00000315757 ENSP00000315757 ENSP00000381581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]