SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169234647|ref|NP_001108446.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169234647|ref|NP_001108446.1|
Domain Number 1 Region: 337-458
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.16e-34
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169234647|ref|NP_001108446.1|
Sequence length 461
Comment smoothelin-like protein 2 isoform 1 [Homo sapiens]
Sequence
MEPAPDAQEARTVREALGRYEAALEGAVRALHEDMRGLQRGVERRVAEAMRLAGPLARTV
ADLQRDNQRLQAQLERLTRQVEALGLASGMSPVPGTPGTPSPPPAPGVPDRAPRLGSARF
ASHATFSLSGRGQSLDHDEASESEMRKTSNSCIMENGHQPGAGPGDGPPEIAQNFSAPDP
PRPRPVSLSLRLPHQPVTAITRVSDRFSGETSAAALSPMSAATLGGLNPSPSEVITPWTP
SPSEKNSSFTWSVPSSGYGAVTASKHSNSPPLVTPPQSPVSPQPPAITQVHRQGERRREL
VRSQTLPRTSEAQARKALFEKWEQETAAGKGKGEARARLKRSQSFGVASASSIKQILLEW
CRSKTLGYQHVDLQNFSSSWSDGMAFCALVHSFFPDAFDYNSLSPTQRQKNFELAFTMAE
NLANCERLIEVEDMMVMGRKPDPMCVFTYVQSLYNHLRRFE
Download sequence
Identical sequences Q2TAL5
NP_001108446.1.87134 NP_001108446.1.92137 ENSP00000373964 gi|169234647|ref|NP_001108446.1| 9606.ENSP00000373964 ENSP00000373964 ENSP00000373964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]