SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194018469|ref|NP_848639.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194018469|ref|NP_848639.2|
Domain Number 1 Region: 55-115
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-24
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 2 Region: 590-646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 365-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.33e-23
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 477-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.46e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 7 Region: 645-702
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.55e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 8 Region: 729-786
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.44e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 9 Region: 771-823
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-21
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 10 Region: 253-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.96e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 11 Region: 533-590
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-18
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 12 Region: 205-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-17
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 13 Region: 692-724
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000153
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|194018469|ref|NP_848639.2|
Sequence length 836
Comment zinc finger protein 546 [Homo sapiens]
Sequence
MQVDPPLHGPPNDFLIFQIIPLHSLSIMPRFLWILCFSMEETQGELTSSCGSKTMANVSL
AFRDVSIDLSQEEWECLDAVQRDLYKDVMLENYSNLVSLGYTIPKPDVITLLEQEKEPWI
VMREGTRNWFTDLEYKYITKNLLSEKNVCKIYLSQLQTGEKSKNTIHEDTIFRNGLQCKH
EFERQERHQMGCVSQMLIQKQISHPLHPKIHAREKSYECKECRKAFRQQSYLIQHLRIHT
GERPYKCMECGKAFCRVGDLRVHHTIHAGERPYECKECGKAFRLHYHLTEHQRIHSGVKP
YECKECGKAFSRVRDLRVHQTIHAGERPYECKECGKAFRLHYQLTEHQRIHTGERPYECK
VCGKTFRVQRHISQHQKIHTGVKPYKCNECGKAFSHGSYLVQHQKIHTGEKPYECKECGK
SFSFHAELARHRRIHTGEKPYECRECGKAFRLQTELTRHHRTHTGEKPYECKECGKAFIC
GYQLTLHLRTHTGEIPYECKECGKTFSSRYHLTQHYRIHTGEKPYICNECGKAFRLQGEL
TRHHRIHTCEKPYECKECGKAFIHSNQFISHQRIHTSESTYICKECGKIFSRRYNLTQHF
KIHTGEKPYICNECGKAFRFQTELTQHHRIHTGEKPYKCTECGKAFIRSTHLTQHHRIHT
GEKPYECTECGKTFSRHYHLTQHHRGHTGEKPYICNECGNAFICSYRLTLHQRIHTGELP
YECKECGKTFSRRYHLTQHFRLHTGEKPYSCKECGNAFRLQAELTRHHIVHTGEKPYKCK
ECGKAFSVNSELTRHHRIHTGEKPYQCKECGKAFIRSDQLTLHQRNHISEEVLCIM
Download sequence
Identical sequences Q86UE3
ENSP00000339823 9606.ENSP00000339823 ENSP00000339823 NP_848639.2.87134 NP_848639.2.92137 XP_011525201.1.92137 gi|194018469|ref|NP_848639.2| ENSP00000339823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]