SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21361176|ref|NP_000680.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21361176|ref|NP_000680.2|
Domain Number 1 Region: 19-499
Classification Level Classification E-value
Superfamily ALDH-like 0
Family ALDH-like 0.000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21361176|ref|NP_000680.2|
Sequence length 501
Comment retinal dehydrogenase 1 [Homo sapiens]
Sequence
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDV
DKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYL
NDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKI
GPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDID
KVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQG
QCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIES
GKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR
ANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGE
YGFHEYTEVKTVTVKISQKNS
Download sequence
Identical sequences G2HJM2 P00352 V9HW83
ENSP00000297785 4wb9_A 4wpn_A 5ac2_A 5l2m_A 5l2n_A 5l2o_A 5l2o_B 5l2o_C 5l2o_D 5l2o_E 5l2o_F 5l2o_G 5l2o_H 9598.ENSPTRP00000035939 9606.ENSP00000297785 ENSPTRP00000035939 NP_000680.2.87134 NP_000680.2.92137 NP_001233476.1.37143 XP_003822242.1.60992 XP_016815805.1.37143 ENSP00000297785 gi|21361176|ref|NP_000680.2| ENSPTRP00000035939 ENSP00000297785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]