SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|215599424|ref|NP_001135938.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|215599424|ref|NP_001135938.1|
Domain Number 1 Region: 27-414
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.56e-68
Family AAT-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|215599424|ref|NP_001135938.1|
Sequence length 423
Comment alanine aminotransferase 2 isoform 2 [Homo sapiens]
Sequence
MGQQPITFLRQVMALCTYPNLLDSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIR
EDVAAYITRRDGGVPADPDNIYLTTGASDGISTILKILVSGGGKSRTGVMIPIPQYPLYS
AVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRK
CIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTS
KGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFE
QFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQM
APDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLE
KYA
Download sequence
Identical sequences A0A2J8VXY9
ENSP00000413804 NP_001135938.1.87134 NP_001135938.1.92137 gi|215599424|ref|NP_001135938.1| ENSP00000413804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]