SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21702735|ref|NP_612439.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21702735|ref|NP_612439.2|
Domain Number 1 Region: 1-351
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.31e-74
Family ADP-ribosylglycohydrolase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21702735|ref|NP_612439.2|
Sequence length 354
Comment [Protein ADP-ribosylarginine] hydrolase-like protein 1 isoform 1 [Homo sapiens]
Sequence
MEKFKAAMLLGSVGDALGYRNVCKENSTVGMKIQEELQRSGGLDHLVLSPGEWPVSDNTI
MHIATAEALTTDYWCLDDLYREMVRCYVEIVEKLPERRPDPATIEGCAQLKPNNYLLAWH
TPFNEKGSGFGAATKAMCIGLRYWKPERLETLIEVSVECGRMTHNHPTGFLGSLCTALFV
SFAAQGKPLVQWGRDMLRAVPLAEEYCRKTIRHTAEYQEHWFYFEAKWQFYLEERKISKD
SENKAIFPDNYDAEEREKTYRKWSSEGRGGRRGHDAPMIAYDALLAAGNSWTELCHRAMF
HGGESAATGTIAGCLFGLLYGLDLVPKGLYQDLEDKEKLEDLGAALYRLSTEEK
Download sequence
Identical sequences Q8NDY3
9606.ENSP00000364567 ENSP00000364567 gi|21702735|ref|NP_612439.2| NP_612439.2.87134 NP_612439.2.92137 ENSP00000364567 ENSP00000364567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]